Green Fluorescent Protein (GFP) Mutants

Green Fluorescent Protein (GFP) MutantsGREEN FLUORESCENT PROTEIN (GFP) MUTANTS WITH ALTERED FLUORESCENCE INTENSITY AND EMMISSION SPECTRAIntroductionNow-a-days GFP is creating revolution in the theme of science by its applications and properties.GFP is a stable protein extracted from the photo organs of the jellyfish Aequoria victoria by Shimomura et al in 1962. In 1992 the cloning of GFP has done. It is found in a variety of coelenterates (both hydrozoa and anthozoa) and it emits light by utilising energy from the Ca2+ activated photoprotein aequorin 1. Energy transfer and the emission spectra of GFP canister be affected by dimerization. grammatical construction of GFP is cylindrical -can structure and has a chromophore located centrally. The chromophore is responsible for the fluorescence and the formation is independent of species but generally depends on oxygen. GFP is a small protein and has been made up of 238 a minute of arco group dits. Deletion of any seven amino acids e ither from C-terminus or N-terminus may result in the loss of fluorescence. Amino acid replacement is responsible for the miscellany in colours of GFP. It has a molecular weight of 27 KDa and has an absorption range at 488 nm and an emission range at 509 nm. It can fulfill high temperatures (65 c) and basic PH range of 6-12 2. Increase in PH results in the decrease of fluorescence. Increase in the fluorescence and photo stability can be achieved by single point mutation at S65T. Fluorophore of the GFP is generated by using auto-catalytic process of continuous mechanisms. Visible excitation is one of the optical properties of GFP. Its derivatives are produced from the mutagenesis experiments interchangeable random and directed mutagenesis 3. GFP is majorly employ as a reporter in expressing genes. Protein and chromophore folding excessively constitutes as a major advantage of GFP. It can in addition be used in protein fusion by applying recombinant DNA technology.Aim of this r esearch is to analyze properties of GFP by cloning, mutations, expression of proteins and purification. Objectives of this research are to sub-clone GFP into a transmitter and mutations are carried come out of the closet by various mutagenesis experiments followed by expression of proteins and purification. Finally after purification properties are analyzed.Materials and constitutionsInitially DNA is isolated and GFPuv is sub-cloned into the pET28c vector from pET23 plasmid by speectrophotometric analysis. 5g of pET23GFPuv DNA is digested by using NdeI and HindIII restriction enzymes. And the digests are analysed by using Agarose change electrophoresis. GFP fragment is extracted and purified using QIA quick gel extraction kit from QIAGEN and the recovered DNA is estimated. Recombinant protein is denotative in E.coli by ligation and transformation. To confirm the comportment of GFP in the pET28c plasmid, colony PCR is used. Further mutagenesis experiments are carried out by des igning oligonucleotide reasons which go out alter the spectral properties of the protein. Complementary primers containing same mutations are generated. Mutagenic primers are prepared with a melting temperature of 78C, length mingled with 25 and 45 bases and primers longer than 45 bases are generally used.Introduction and identification of mutations within GFPuv geneMutations are created in the GFPuv insert by site-directed mutagenesisSite-directed mutagenesis5l 10 x PCR buffer5l 20 mM dNTP mixes15 ng GFPuv-pET28c template DNA125ng oligonucleotide primer F+125ng oligonucleotide primer R+2l 25mM MgSo432l sterile water1l KOD hot start polymerase (1U/l)* All the above are added to 0.2ml PCR tubes and incubated in a PCR machine for 24 cycles94C 30s94C 30s55C 1min68C 4min 20s68C 10 min* Reaction is accordingly kept on ice for 2 min and 1l (1U) of Dpn1 is added and incubated for 60 min at 37C bond of amino acid sequences is carried out using http//www.ebi.ac.uk/Tools/clustalw2/index. htmlProduct of site-directed mutagenesis (pET28c DNA) is trans make into XL-1 supercompetent cells.Transformed colonies are extracted using QIAprep Mini prep kit Qiagen 5. Concentration and purity can be checked by using Agarose gel electrophoresis. For this 5l of plasmid preparation and 10U HindIII are digested at 37C for 1h. Sequencing is then carried out by using 10l of DNA at a concentration of 50ng/l.E.coli BL21 (DE3) cells are prepared and are transformed into the pET28cGFPuv plasmid for expressionAuto-induction methodWild case protein (GFPuv) and the mutant protein are expressed in the expression vector BL21 (DE3) using auto-induction method. For this transformed colonies are inoculated into 3ml of LB-1D + antibiotic media and incubated at 37C at ccc RPM for 6 hrs and O.D is taken. Inoculum is taken into the flask containing SB-5052 auto-induction medium along with antibiotic and incubated at 28C at 300 RPM for 20 hrs. Cultures are then cooled for 1 hr.Total induced sampling is prepared by taking 100l of cooling socialization and 900l of SB-5052 media. cubicles are then pelletized by centrifuging it with both total induced and non-induced consumes and are resuspended in 100l of SDS-PAGE (sodium dodecyl sulphate (SDS) polyacrylamide gel electrophoresis(PAGE)) savour buffer. 12% of polyacrylamide gel is prepared and the Soluble and insoluble samples are prepared by cell fractionation using BUGBUSTER. For this 1l of DNAase1 is used along with reagents. Cell suspension is then centrifuged at 13000rpm for 20mins. Supernatant is then used as soluble sample and insoluble is prepared by resuspending the pellet in 2ml screen buffer.SDS-PAGE buffer and binding buffer are added to the soluble and insoluble fractions. At 95C all samples are heated for 5 min.Gel is then loaded asMolecular weight standard-5lUninduced sample 5lInduced total sample 5lSoluble sample 5lGel has to run for 1 hr. And is transfered to a box of Coomassie blue stain.Western blottingGFP pr otein presence can be verified using western sandwich blotting technique. Protein samples are first seperated by SDS-PAGE and are transferred to the nitrocellulose membrane. GFP bound to nitrocellulose membrane is then visualised by incubating the blot with His-probe which is linked to a HRP (horse daikon peroxidase) enzyme (HisprobeTM-HRP solution is diluted to 15000 (1l in 5ml) ). His-tag of GFP protein is bound to probe. Blots are kept in TBST and probes and thus probes are visualised by chemiluminescence and these are photographed by chemiluminescent reader.Ni-NTA chromatographyHis tagged GFP can be purified by Ni-NTA (nickel nitrilo triacetic acid) chromatography method. In this, sample of soluble protein is loaded on column packed agarose resin and the non-specific protein binding is outback(a) by washing resin with buffer and is eluted by high concentrated imidazole of elution buffer. After elution the purification of protein is done by SDS-PAGE and Coomassie staining. The c oncentration of the protein is measured by Bradford assay.Fluorimetry and mass spectrometryProperties of GFPuv protein are analysed by Fluorimetry and mass spectroscopy.FluorimetryIn this wavelength and intensity of a molecule at specific wavelength are measured using fluorimeters. Perkin Elmer LS50B is the fluorimeter used to measure GFP. Quartz cuvettes are placed in a chamber to measure the concentration and intensity. The parameters set to measure GFP areExcitation 440nmEmission 460-550nm scratch line widths 4 and 4Accumulation 520g/ml of protein concentration is used. The emission and excitor wavelengths are set at 509nm and 395nm.Mass spectrometryGFPuv properties and molecular mass can be analysed by mass spectroscopy. The type of mass spectroscopy used here is electron spray ionization (ESI). ESI is a type of atmospheric pressure ionisation technique (API) which is used for biochemical analysis. JEOL HX110/HX110A equipped with electron ion source tandem mass spectrometers are used to analyse geomorphologic properties 7. 1-10 pmol/l of protein concentration is used.Solvents used areMeOHMeCNTFADuring ionisation sample is dissolved in a solvent and is pumped through a steel capillary tubing at a rate of 1l/min and voltage of 3 or 4KV is applied 8. Ion current is amplified by the detector and the data system will record signals in the form of mass spectrum.RESULTSSite-directed mutagenesisPrimers used for site directed mutagenesis (Mutant)Forward primer 5-CACTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCC-3Reverse primer 5-GGAAAAGCATTGAACACCCCAAGAGAAAGTAGTGACAAGTG-3Alignment of the amino acid sequence of the mutant with the GFPuv amino acid sequenceGFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60mGFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60************************************************************GFPuv VTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 mGFPuv VTTFSWGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNY KTRAEVKFEGDTLV 120***********************************************************Y66WGFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 mGFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180************************************************************GFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238mGFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238**********************************************************Amino acid substitution Y66WBelongs to company 5, indole in chromophore (cyan fluorescent proteins) 6eCFP CATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 60GFP ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 57*********************************************************eCFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 120GFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 117************************************************************eCFP GGAAAACTTACCCTTAAATTTATT TGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 180GFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 177************************************************************eCFP CTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAA 240GFP CTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAA 237******************* ******************************** ******MutationeCFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 300GFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 297************************************************************eCFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 360GFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 357************************************************************eCFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 420GFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 417************************************************************eCFP AAACTCGAGTACAACTATAACTCACACAA TGTATACATCACGGCAGACAAACAAAAGAAT 480GFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 477************************************************************eCFP GGAATCAAAGCT 492GFP GGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCA 537************eCFP GFP GACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCAT 597eCFP GFP TACCTGTCGACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTC 657eCFP GFP CTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAATAA 717SDS-PAGE Coomassie staining gel of (Sample 6)Marker GFP protein (soluble sample)Western blotting (Sample 11)Induced total sample GFP proteinNi-NTA chromatographyFluorimetryMass spectrometryWild-typeMutantDiscussionSite-directed mutagenesisIn the site-directed mutagenesis mutation is carried out at the right place i.e., at 197 and 198 places. Tyrosine (TAT) is mutated to tryptophan (TGG), Y W. During this mutation protein undergoes many a(prenominal) changes especially in the fluorescence. GFP turns into CFP ( blue-green fluorescent protein) hence the light emitted will not be exactly green. CFP will have many peculiar features like quite an than single excitation and emission peaks it possess double humping.Tag CFP possess some properties likeStructure monomerMolecular weight 27KDaPolypeptide length 239aaFluorescence colour CyanMaximum excitation 458nmMaximum emission 480nmExcitation coefficient 37000M-1 cm-1Pka 4.7Quantum yield 0.57Brightness 21.1Brightness is produced by the quantum yield and extinction coefficient. Dual colour visualisation of the protein expressed is enabled by the CFP. This has led to the Fluorescence Resonance Energy Development (FRET).SDS-PAGESDS-PAGE is carried out to separate proteins according to their electrophoretic mobility and experimental repeats will result in the purity appraisal of the protein. Four wells are loaded with samples and 2 and 4 wells show protein result and as 1 and 3 wells dont contain protein they will be normal without any bands. Resu lts shows that little amount of GFP has been observed in the insoluble and large amount of protein has been observed in the soluble sample. Uninduced sample cannot discern GFP.Western-blottingWestern-blot is performed to make sure the presence of protein. Histidine tagged probe is added to confirm the protein present was GFP or not. pET28c plasmid contains T7 RNA polymerase actor sequence. But this promoter is blocked by the repressor. Hence lactose containing medium is required for E.coli growth. Because lactose is used as carbon source, glucose is converted into allolactose. This allolactose will bind to repressor by unblocking promoter, and expresses GFP. Hence presence of glucose will result in Lac-I and is binds to the operator.Band observed in the blot is probably GFP and it has high level of intensity after induction. And it is necessary to confirm this by performing blotting technique using His probe to detect His tagged GFP. Bands are observed in the induced and soluble s amples after performing western blotting substantiative the presence of GFP.Ni-NTA chromatographyPurification of GFP can be done by Ni-NTA chromatography. For a recombinant protein the amino acid binding site with 6 or more His residues in a row acts as metal binding site. So hexa-his sequence is called as His-tag. His-tag sequence is present in the N-terminal of the target protein and is located in the promoter region adjacently to the GFP gene. During this process enzyme HRP is also bound to the probe. This HRP-probe will react with luminal 4 peroxidase buffer which is further used for purifying GFP by Ni-NTA chromatography. Purification by His-tagged GFP can be done by using several methods like Ni2+-poly (2 acetomidoacrylic acid) hydrogel. Displacement of GFP can be done by binding nickel to imidazole. This is mainly because of high affinity of nickel towards imidazole compared to GFP.Distinctive bands are supposed to observe in the elute1, elute 2 and also in the total soluble fraction. Bands formed states the presence of the GFP mutant. Absence of the bands states mutant absence.In the results bands are observed at the total induced and the soluble samples which state the protein presence. Even small amounts of bands are also observed in the insoluble sample. GFP protein produced in the induced total sample is approximately at 27KDa. Slight bands are observed in the insoluble sample as it may be because of some impurities. Finally the GFP protein has been detected.References1. Davenport D, Nichol JAC Luminescence in Hydromedusae. Proceedings of the Royal Society, Series B 1955, 144399-4112. Ward. W., Prentice, H., Roth, A. Cody. C. and Reeeves.S.1982.Spectral perturbations of the Aequoria green fluorescent protein. Photochem. Photobiol. 35803-8083. Cormack, B. P., Valdivia, R. H., Falkow, S. (1996). FACS-optimized mutants of the green fluorescent protein (GFP). Gene, In press4. Darelle Thomson , Greg Smith. (2001).PCR-based plasmid vector construction f or generation of recombinant viruses. Journal of Virological Methods 94, 7-145. Vogelstein, B., and Gillespie, D. (1979) Preparative and analytical purification of DNA from agarose. Proc. Natl. Acad. Sci. regular army 76, 615-619.6. HEIM, R., PRASHER, D. C. TSIEN, R. Y. 1994. Wavelength Mutations and Posttranslational Autoxidation of Green Fluorescent Protein. Proceedings of the National Academy of Sciences of the United States of America, 91, 12501-12504.7. HARUKI NIWA, SATOSHI INOUYE et,al., Chemical nature of the light emitter of the Aequorea green fluorescent protein. Vol. 93, pp. 13617-13622, November 1996. Proc. Natl. Acad. Sci. USA.8. Mass Spectrometry A psychiatric hospital Course, K. Downard, Royal Society of Chemistry, UK, 2004.